561,692 Free Images of The Museum

cc-zerofiles uploaded by daderotvehicleaircraftcc-pd-markmilitaryarchitectureaviationpages with maps2012 photographs
Mesosaurus braziliensis, view 2, Early Permian, Irati Formation, Passa Dois Group, Itapetinginga, Brazil - Houston Museum of Natural Science - DSC01779
animalscc-zero
Mask for shaman's initiation ritual, Dao (Dao Ho) - Vietnam Museum of Ethnology - Hanoi, Vietnam - DSC02959
self-published workcc-zero
Mask, Timbunke, Middle Sepik River Valley, New Guinea, 1912-1913 - Südseeabteilung - Ethnological Museum, Berlin - DSC00988
self-published workcc-zero
Mask - Manongwe, Ngare, or Mboko people, Mossaka, near Likoula River, Republic of the Congo, 19th century, wood, pigment - Brooklyn Museum - Brooklyn, NY - DSC08563
self-published workmetal
Mask, Middle Sepik, Masandamai Village, C-14 dating of 650-780 AD with 95.4% probability, wood, pigment - De Young Museum - DSC01031
self-published workcc-zero
St. Gregory the Great, Spain, artist unknown, 1575-1600, polychromed and gilded wood with estofado - Chazen Museum of Art - DSC02011
self-published workcc-zero
Storage jar (olla), New Mexico, Laguna Pueblo, late 1800s, earthenware and pigment - De Young Museum - DSC00302
browngold
Storehouse (pataka) side wall portraying humans attacked by manaia, Maori, Ohinemutu beside Lake Rotorua, c. 1830 - Ethnological Museum, Berlin - DSC01226
self-published workart of polynesia
Textile exhibits - Tokyo National Museum - Tokyo, Japan - DSC08829
self-published workcc-pd-mark
The Youthful Diana by Anna Hyatt Huntington, c. 1924, bronze - San Diego Museum of Art - DSC06754
anna hyatt huntingtonself-published work
State archaeology museum
self-published workarchitecture
Standing Female Figure, 400 BC - 500 AD, Jama Coaque style, Chone sub-style, Ecuador, earthenware with various pigments - Gardiner Museum, Toronto - DSC01204
files uploaded by daderotcc-zero
Standing Female Figure with huipil and skirt, 500-800 AD, Nopiloa style, Veracruz, Mexico, earthenware with traces of white slip - Gardiner Museum, Toronto - DSC01142
files uploaded by daderotcc-zero
Standing Buddha on a lotus dais, Korea, Unified Silla period, 8th century, gilt bronze - Royal Ontario Museum - DSC04197
self-published workcc-zero
Spirit ship (tiweh), Borneo, Bentian Dayak, Honolulu Museum of Art
vehiclewater
Spoon from East Timor, 20th century, Honolulu Museum of Art V
self-published work2012 photographs
Spoon from East Timor, 20th century, Honolulu Museum of Art III
self-published work2012 photographs
Stairway - Finnish Museum of Natural History - DSC04542
architectureinterior
Sugar bowl, c. 1900, English, Royal Crown Derby, hard-paste porcelain, Honolulu Museum of Art
self-published workcc-zero
Teotihuacan-style incense burner depicting a ruler and his court, Maya, Early Classic Period, 250-600 AD, ceramic - Royal Ontario Museum - DSC04482
self-published workcc-zero
Teapot with reptile-head spout, c. 1720-1723, Du Paquier factory, hard-paste porcelain, underglaze blue, overglaze purple enamel, gilding - Gardiner Museum, Toronto - DSC00987
files uploaded by daderotcc-zero
Tea set from China, 1804 AD, ceramics - Museum of Vietnamese History - Ho Chi Minh City - DSC05843
self-published workcc-zero
Portable desk on stand, unidentified - Cape Ann Museum - Gloucester, MA - DSC01272
self-published workindoor
Portrait of Esther McLaughlin (the artist's niece), by Mary Louise McLaughlin, 1882, Haviland and Company porcelain blank - Cincinnati Art Museum - DSC03079
american ceramics in the cincinnati art museumself-published work
Portrait of Maria Clarissa Leavitt by Samuel Lovett Waldo, c. 1820-1825, oil on panel - Brooklyn Museum - DSC09283
19th-century portrait paintings in the brooklyn museumself-published work
Possible broom, twill pattern, 1100-1400 AD, San Juan Anasazi, Turkey House, Arizona, yucca - Natural History Museum of Utah - DSC07322
anasazi basketry in the natural history museum of utahself-published work
Porringer by Thomas D. & Sherman Boardman, Hartford, CT, early 1800s - Joseph Allen Skinner Museum - DSC07836
self-published workbowl
Ovis dalli stonei - Mount Angel Abbey Museum - Mount Angel Abbey - Mount Angel, Oregon - DSC00083
wildlifeanimals
Ovoid Vase, Japan (Kyoto), attributed to Kinkozan workshop, 1870s-1920s, earthenware with overglaze and gold on dark cobalt - Chazen Museum of Art - DSC02378
self-published workcc-zero
Ovis dalli stonei - Mount Angel Abbey Museum - Mount Angel Abbey - Mount Angel, Oregon - DSC09992
wildlifeanimals
Northern Ostrobothnia museum Oulu 20200229
wintertree
North American SNJ-4 Texan, 1943 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00616
militaryvehicle
Nanda the cowherd, Kizil, Cave of the Statues (Cave 77), 406-425 AD, wall painting - Ethnological Museum, Berlin - DSC01776
art of kizil in the ethnological museum, berlinself-published work
Mihrab (prayer niche), Iran or Central Asia, late 15th or 16th century, glazed ceramic tile - Cincinnati Art Museum - DSC03262
self-published workarchitecture
Mihrab panel, unknown artist, Ottoman Anatolian or Northern Syria, about 1604-1605, glazed ceramic tile, view 2 - Hood Museum of Art - DSC09084
self-published workcc-zero
Miranda and Isala Van Diest, sisters, by Pierre Joseph Steger, c. 1855 - Museum M - Leuven, Belgium - DSC05266
self-published workcc-zero
Lockheed SR-71A Blackbird, 1966 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01013
militaryvehicle
Lockheed GTD-21B drone, 1966 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01072
militaryaircraft
Maize and Blue solar car, University of Michigan, 1993 - Museum of Science and Industry (Chicago) - DSC06862
vehiclecar
Man's imperial court robe, China, 1919, silk with gold and silver metallic thread, view 1 - Hood Museum of Art - DSC09264
asian art in the hood museum of artself-published work
Mandarin robe, view 1, Manchu peoples, China, late 19th century, silk - Fernbank Museum of Natural History - DSC09988
self-published workcc-zero
Man's szur (mantle), view 2, Hungary, c. 1890, wool, leather, copper, applique - Royal Ontario Museum - DSC04429
self-published workcc-zero
Klimov VK-1F turbojet engine, from Shenyang J-5, view 2 - Oregon Air and Space Museum - Eugene, Oregon - DSC09775
self-published workcc-zero
Longquan ware dish, China, Song-Yuan dynasty, c. 1250-1368, glazed porcellanous stoneware - Royal Ontario Museum - DSC04225
self-published workcc-zero
Male figure, Haniwa, excavated at Gunma prefecture, Japan, Tumulus period, 6th-7th century AD, terracotta - Hakone Museum of Art - Hakone, Kanagawa, Japan - DSC08141
self-published workcc-zero
Long-neck bottle, Sue ware, Heian period, 900s AD, ceramic - Hakone Museum of Art - Hakone, Kanagawa, Japan - DSC08215
self-published workcc-zero
Library at the Teylers museum, photo-4, Cabinet of Boudewijn Buch
boudewijn bücharchitecture
Incised limestone bench support, perhaps depicting head of Chaak, Classic Maya, Palenque, Chiapas, Mexico - San Diego Museum of Man - DSC06879 03
self-published workcc-zero
Incised bat claw vessel with glyph reptile's eye on paw, and cylinder, Zapotec, Oaxaca, Mexico, 200-500 AD, clay - Royal Ontario Museum - DSC04514
self-published workcc-zero
Interior - University of Arizona Museum of Art - University of Arizona - Tucson, AZ - DSC08066
self-published workinterior
Gent-Museum Dr Guislain (24)
villagetravel
Grumman F-14D Super Tomcat, 1987 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00385
aircraftvehicle
F-104 German Marine 23+09 pic2
militaryaircraft
Fairchild PT-19, 1939 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00613
militaryaircraft
Holy Bishop John Chrysostom, Arkhangelsk Regional Museum of Fine Arts
15th-century icons of russiaself-published work
Unidentified buddha - Royal Ontario Museum - DSC04103
self-published workcc-zero
Uniform coat of Darius Nash Couch, Brigadier General, c. 1861 - Old Colony History Museum - Taunton, Massachusetts - DSC03956
self-published workcc-zero
Various netsuke - Fairbanks Museum and Planetarium - DSC04345
self-published worknetsuke
Vase, Valentien Pottery, Albert Robert Valentien decorator, 1911-1914, glazed earthenware - Cincinnati Art Museum - DSC04527
albert robert valentienself-published work
Vase, Vinh Phuc province, Ly dynasty, 11th-12th century AD, stoneware - Museum of Vietnamese History - Ho Chi Minh City - DSC06191
self-published workcc-zero
Vase - Wedgwood, c. 1795 - Brooklyn Museum - DSC09028
self-published workcc-pd-mark
Vase (Perruches) by René Jules Lalique, 1922, blown four mold glass - Cincinnati Art Museum - DSC04355
self-published work1922 in art
Uniforms (left to right) Army Air Corps Enlisted Tunic, Army Enlisted Tunic, Army Officer's Dress Tunic) - Wisconsin Veterans Museum - DSC03043
pink and greenmilitary
Puppets - Sichuan University Museum - Chengdu, China - DSC06188
self-published workcc-pd-mark
Radio display - Museum für Angewandte Kunst Köln - Cologne, Germany - DSC09660
self-published workcc-zero
Rocket Launchers, M1A1 2.36 inch Bazooka, M20 3.5 inch Super Bazooka, M6A1 2.36 Inch HEAT - Fort Devens Museum - DSC07081
self-published workbazooka
Tete-a-Tete Tea Set, designed by Karl L. H. Mueller, Union Porcelain Works, Greenpoint, Brooklyn, c. 1876, porcelain - Brooklyn Museum - DSC09611
self-published workcc-zero
Tray for betel chews, Bac Ninh, late 19th century, view 1, wood inlaid with mother of pearl - Vietnamese Women's Museum - Hanoi, Vietnam - DSC04167
self-published workcc-zero
Transformation mask, Kwakiutl, collected in Tsatsichnukwumi village on Harbledown Island in 1917 - Native American collection - Peabody Museum, Harvard University - DSC05607
files uploaded by daderotcc-zero
Trading Aardolie Produkten, Enamel advert sign at the den hartog ford museum pic-008
with trademarkcc-zero
Riders by Bernhard Hoetger, possibly a replica, date unknown - Museum Künstlerkolonie Darmstadt - Mathildenhöhe - Darmstadt, Germany - DSC06408
self-published workfop-germany
Edo Castle, 1 to 30 architectural model, based on plans from the mid 1800s - Edo-Tokyo Museum - Sumida, Tokyo, Japan - DSC06589
architectural models of edo castle (edo-tokyo museum)self-published work
Isana, My Son B, 10th century Quang Nam - Museum of Cham Sculpture - Danang, Vietnam - DSC01695
9th - 11th centuries in the champa cultureself-published work
Jar, Bizen ware, Momoyama period, 1500s AD, ceramic - Hakone Museum of Art - Hakone, Kanagawa, Japan - DSC08161
self-published workbrown
Formal outer kimono (uchikake), Japan, view 2, mid to late 20th century, silk, silk floss, silver and gold thread - Textile Museum of Canada - DSC01037
self-published workcc-zero
Formal outer kimono (uchikake), Japan, view 1, mid to late 20th century, silk, silk floss, silver and gold thread - Textile Museum of Canada - DSC01032
self-published workcc-zero
Landscape, inscription by Nanko Sogen (1387-1463), Muromachi period, 15th century, ink and light color on paper, view 1 - Tokyo National Museum - DSC05833
self-published workcc-zero
Three-color Glazed Vase, Nara period, 8th century, from Minami-ku, Kyoto-shi, Kyoto - Tokyo National Museum - DSC06441
self-published workcc-zero
Rolls-Royce New Phantom, 1929, view 1 - Museum of Science and Industry (Chicago) - DSC06870
vehiclecar
Rockport Waterfront by Anthony Thieme, c. 1930s, oil on canvas - Cape Ann Museum - Gloucester, MA - DSC01410
vehiclewater
Toshiba VJ-3 electric washing machine, 1956 AD - Edo-Tokyo Museum - Sumida, Tokyo, Japan - DSC06985
appliances in the edo-tokyo museumself-published work
Spoon from East Timor, 20th century, Honolulu Museum of Art IV
self-published work2012 photographs
Teapot, c. 1719-1725, decorated in Dresden or Augsburg c. 1725-1730, Meissen, modeller Johann Jacob Irminger, Bottger hard-paste porcelain, gilding - Gardiner Museum, Toronto - DSC01065
files uploaded by daderotcc-zero
Sword scabbard (detail), Japan, artist unknown, carved ivory - George Walter Vincent Smith Art Museum - DSC03538
self-published workcc-zero
Tapa cloth with black designs and fringe, Fiji, collected 1930 - Pacific collection - Peabody Museum, Harvard University - DSC05739
art of fijigold
Sujikabuto style helmet bowl with 62 ridges, by Fusamune, Muromachi period, dated 1538 (Tenbun 7) - Tokyo National Museum - DSC05911
self-published workcc-zero
Oulu Museum of Art Interior 20170813 03
interiorindoor
Old Man God (God 5F), Mexico, Monte Alban III, Zapotec, 350-600 AD, earthenware - De Young Museum - DSC00466
self-published workcc-zero
Electronic Secretary Model R1, view 2, made by Electronic Secretary Industries, Milwaukee, Wisconsin, 1949 - Wisconsin Historical Museum - DSC02811
self-published workcc-zero
Myoglobin protein model, created by Dr. John Kendrew and technician at Cambridge University, 1965 - National Museum of American History - DSC00018
self-published workcc-zero
Tipi cover, Blood, mid to late 19th century, begun by Pennaquim in the 1830s, continued by Red Crow, Many Mules, and Crazy Crow - Glenbow Museum - DSC00569
self-published workcc-zero
Relief of Apollo with Nike, 27 BC - 14 AD, Roman, Italy, marble - Cleveland Museum of Art - DSC08316
ancient roman reliefs in the united statescc-zero
X-32 Patuxent River Naval Air Museum Front View
aircraftvehicle
Case 18 - Uniform vs Strip Sheltwood Cutting for Natural Reproduction - Dioramas in the Fisher Museum (Harvard Forest) - DSC07315
glowdusk
Ceramic shoes given as wedding gifts, Netherlands, 1690-1700 - Bata Shoe Museum - DSC00197
self-published work1690s clothing
Tripod vessel, Ru ware, China, Northern Song Dynasty, late 11th or early 12 century, stoneware - Cincinnati Art Museum - DSC03179
self-published workcc-zero
Trunk - Northeast States Civilian Conservation Corps Museum - Shenipsit State Forest - Stafford Springs, Connecticut - DSC04245
self-published workboxing
British Museum Roman Empire 18022019 Mould-blown glass bottle Fish 5836
ancient roman glasswareself-published work
Collar for a ceremonial huipil, gola San Cristobal Totonicapan, K'iche' Maya, c. 1930s-1940s, cotton, silk, commercial cotton - Textile Museum of Canada - DSC01047
self-published workcc-zero
Cult object, Kinh ethnic group, Bac Ninh, colored paper - Vietnam National Museum of Fine Arts - Hanoi, Vietnam - DSC05230
self-published workcc-zero
34801 - 34900 of 561,692 Next page
/ 5617